FOXC2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FOXC2 antibody: synthetic peptide directed towards the C terminal of human FOXC2. Synthetic peptide located within the following region: PQPGAAAAQAASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	54 kDa
Gene Name	forkhead box C2
Database Link	NP_005242 Entrez Gene 2303 Human UniProt ID Q99958
Background	FOXC2 belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues.
Synonyms	FKHL14; LD; MFH-1; MFH1
Note	Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Rat: 92%; Mouse: 92%; Bovine: 92%; Pig: 85%; Guinea pig: 85%
Reference Data
Protein Families	Druggable Genome, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.