FOXC2 (NM_005251) Human Recombinant Protein
CAT#: TP323412
Recombinant protein of human forkhead box C2 (MFH-1, mesenchyme forkhead 1) (FOXC2), 20 µg
View other "FOXC2" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223412 representing NM_005251
Red=Cloning site Green=Tags(s) MQARYSVSDPNALGVVPYLSEQNYYRAAGSYGGMASPMGVYSGHPEQYSAGMGRSYAPYHHHQPAAPKDL VKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKP GKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKGAPATPHLADAPKEAEKK VVIKSEAASPALPVITKVETLSPESALQGSPRSAASTPAGSPDGSLPEHHAAAPNGLPGFSVENIMTLRT SPPGGELSPGAGRAGLVVPPLALPYAAAPPAAYGQPCAQGLEAGAAGGYQCSMRAMSLYTGAERPAHMCV PPALDEALSDHPSGPTSPLSALNLAAGQEGALAATGHHHQHHGHHHPQAPPPPPAPQPQPTPQPGAAAAQ AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRH AAPYSYDCTKY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 53.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005242 |
Locus ID | 2303 |
UniProt ID | Q99958 |
Refseq Size | 1506 |
Cytogenetics | 16q24.1 |
Refseq ORF | 1503 |
Synonyms | FKHL14; LD; MFH-1; MFH1 |
Summary | This gene belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the development of mesenchymal tissues. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401613 | FOXC2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401613 | Transient overexpression lysate of forkhead box C2 (MFH-1, mesenchyme forkhead 1) (FOXC2) |
CNY 4,840.00 |
|
PH323412 | FOXC2 MS Standard C13 and N15-labeled recombinant protein (NP_005242) |
CNY 19,520.00 |
|
TP760662 | Purified recombinant protein of Human forkhead box C2 (MFH-1, mesenchyme forkhead 1) (FOXC2), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |