Recombinant VEGF121 (Vascular endothelial growth factor 121), Mouse

CAT#: TP728376S

Recombinant VEGF121 (Vascular endothelial growth factor 121), Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 700.00


货期*
2周

规格
    • 5 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 15.01 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Purity >95% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce proliferation in HUVEC cells. The ED₅₀ for this effect is <3 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID Q00731
Synonyms VPF
Summary Vascular Endothelial Growth Factors 121 (VEGF121) is a truncated version of VEGF165, which produced in E. coli is a homodimer, non-glycosylated, polypeptide chain and having a molecular mass of 28.4 kDa. There is three different isoforms (120, 164 and 188 a.a.) found in mouse. VEGF 121 shows that lack basic heparin-binding regions and are freely diffusible. Mouse VEGF121 shares 98% identity with corresponding regions of rat, 89% with canine, feline, equine and porcine, and 87% with human, ovine and bovine VEGF, respectively.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...