Recombinant TNF beta (Tumor necrosis factor beta),Mouse

CAT#: TP728373

Recombinant TNF beta (Tumor necrosis factor beta),Mouse



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 19.36 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce cytotoxicity in L929 cells in the presence of vactinomycin D. The ED₅₀ for this effect is <30 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P09225
Synonyms TNFSF1B, Lymphotoxin-alpha (LT-α), LTalpha, Ltx, TNF-be, TNFSF1, Tnf, Tnfb, Tnfsf, Tnfsf1b, Tnlg1e, hlb38, hlb382, lymph
Summary Tumor Necrosis Factor Beta (TNF beta) or lymphotoxin-alpha (LT-α) is a 19 kDa tumor necrosis factor family protein with 171 amino acid residues. TNF beta is mainly expressed from lymphocytes, and mediates variety of inflammatory, immunostimulatory, and antiviral responses. TNF beta also involves development in secondary lymphoid organs. It is cytotoxic for different tumor cells in vitro and in vivo.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...