Recombinant LIGHT,Mouse

CAT#: TP728365

Recombinant LIGHT,Mouse



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MRLHQRLGDIVAHLPDGGKGSWEKLIQDQRSHQANPAAHLTGANASLIGIGGPLLWETRLGLAFLRGLTYHDGALVTMEPGYYYVYSKVQLSGVGCPQGLANGLPITHGLYKRTSRYPKELELLVSRRSPCGRANSSRVWWDSSFLGGVVHLEAGEEVVVRVPGNRLVRPRDGTRSYFGAFMV with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 20.92 kDa. The protein migrates about 17 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce cytotoxicity in HT-29 cells. The ED₅₀ for this effect is <2 μg/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID Q9QYH9
Synonyms TNFSF14, HVEM-L, CD258, Ly113, LTg
Summary LIGHT, also known as TNFSF14 is a member of the TNF superfamily that produced by multiple immune cells such as activated T cells and immature dendritic cells (DCs). Mouse LIGHT shares 79% sequence homology with human LIGHT. LIGHT is a 29 kDa type II transmembrane protein, which serves as a ligand for both lymphotoxin β receptor (LTβR) and TNFSF signaling receptors (TNFRSF14/HVEM). Besides, LIGHT can amplify NF-kB signaling pathway in T cells when presencing anti-CD3 antibody treatment. Additionally, LIGHT is able to stimulate T cell proliferation and IFN expression via interacting with TNFRS13 /HVEM.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...