Recombinant IL-36 alpha (Interleukin-36 alpha), Mouse

CAT#: TP728356L

Recombinant IL-36 alpha (Interleukin-36 alpha), Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 22,000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 18.82 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce IL-6 secretion in 3T3 cells. The ED₅₀ for this effect is <15 ng/mL. The specific activity of recombinant mouse IL-36 alpha is > 1 x 10⁵ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID Q9JLA2
Synonyms IL36A, Interleukin-1 family member 6 (IL-1F6), FIL1ε (FIL1E), Interleukin-1ε (IL1E), Fi, Fil, Fil1, IL-1, IL-1H1, IL1RP2
Summary Interleukin 36 alpha (IL-36 alpha) is a 17.76 kDa cytokine with 160 amino acid residues. IL-36 alpha is an IL-1 family member, which binds to the Interleukin-1 receptor and is expressed in the lung, stomach, and placenta. IL-36 alpha is critical in inflammatory responses and stimulates the production of proinflammatory cytokines, such as IL-12, IL-1β, IL-6, and TNF-α. It also induces the generation of IFNγ, IL-4, and IL-17 in CD4+ T cells.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...