Recombinant IL-33 (Interleukin-33), Mouse

CAT#: TP728354

Recombinant IL-33 (Interleukin-33), Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MSIQGTSLLTQSPASLSTYNDQSVSFVLENGCYVINVDDSGKDQEQDQVLLRYYESPCPASQSGDGVDGKKLMVNMSPIKDTDIWLHANDKDYSVELQRGDVSPPEQAFFVLHKKSSDFVSFECKNLPGTYIGVKDNQLALVEEKDESCNNIMFKLSKI with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 18.51 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce proliferation in D10.G4.1 cells. The ED₅₀ for this effect is <40 pg/mL. The specific activity of recombinant mouse IL-33 is > 2 x 10⁷ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID Q8BVZ5
Synonyms IL-1 F11, NF-HEV, 9230117N10Rik
Summary Interleukin 33 (IL-33) is a 17.65 kDa cytokine with 159 amino acid residues. IL-33 is a member of the IL-1 family and secreted from various cell types, such as mast cells, macrophages, endothelial cells, and epithelial cells. IL-33 activates NF-κB and MAPK signaling pathways that stimulate the secretion of type 2 cytokines like IL-5 and IL-13 when IL-33 binds to the ST2 receptor primarily expressed in mast cells and Th2 cells. In addition to Th type 2 responses, IL-33 participates in maintaining barrier tissue defense.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...