Recombinant IL-21 (Interleukin-21), Mouse
CAT#: TP728345
Recombinant IL-21 (Interleukin-21), Mouse
Need it in bulk or customized? Get a free quote |
CN¥ 1,890.00
货期*
2周
规格
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MHKSSPQGPDRLLIRLRHLIDIVEQLKIYENDLDPELLSAPQDVKGHCEHAAFACFQKAKLKPSNPGNNKTFIIDLVAQLRRRLPARRGGKKQKHIAKCPSCDSYEKRTPKEFLERLKWLLQKMIHQHLS with polyhistidine tag at the C-terminus.
|
Tag | His Tag (C-term) |
Predicted MW | The protein has a calculated MW of 15.9 kDa. The protein migrates as 16 kDa under reducing condition (SDS-PAGE analysis). |
Purity | >95% as determined by SDS-PAGE. |
Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
Applications | Cell culture |
Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
Bioactivity | Measure by its ability to enhance IFN gamma secretion in NK-92 cells. The ED₅₀ for this effect is <6 ng/mL. The specific activity of recombinant mouse IL-21 is > 1.6 x 10⁵ IU/mg. |
Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
Reference Data | |
UniProt ID | Q9ES17 |
Synonyms | Za11 |
Summary | Interleukin-21 (IL-21) belongs to the IL-15/IL-21 family, which exerts pleiotropic immune regulations. IL-21 produced primarily by natural killer T (NKT) cells, T follicular helper (TFH) cells and TH17 cells. As a pleiotropic cytokine, IL-21 has been shown to regulate both innate and humoral immunity. It has potent inhibitory activity towards the activation and maturation of granulocyte-macrophage colony-stimulating factor (GM-CSF)-induced dendritic cells (DCs). In B cells, IL-21 has a major role in the development of immunoglobulin responses. In T cells, it is required to facilitate the functional differentiation of several CD4+ T cell subsets. In addition, the ability of IL-21 to enhance the cytotoxic activity of both CD8+ T cells and NK cells makes it as a potential antitumor agent. |
Documents
FAQs |
SDS |
Customer
Reviews
Loading...