Recombinant IL-15 (Interleukin-15), Mouse
CAT#: TP728336S
Recombinant IL-15 (Interleukin-15), Mouse
Need it in bulk or customized? Get a free quote |
CN¥ 700.00
货期*
2周
规格
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS with polyhistidine tag at the N-terminus.
|
Tag | His Tag (N-term) |
Predicted MW | The protein has a calculated MW of 14.2 kDa. The protein migrates as 11-14 kDa under reducing condition (SDS-PAGE analysis). |
Purity | >98% as determined by SDS-PAGE. |
Buffer | The protein was lyophilized from a 0.2 µm filtered solution of Proleukin buffer, pH 7.5.containing 1X PBS, pH 7.4. |
Applications | Cell culture |
Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
Bioactivity | Measure by its ability to induce CTLL-2 cells proliferation. The ED₅₀ for this effect is <10 ng/mL. The specific activity of recombinant mouse IL-15 is approximately >1x 10⁵ IU/mg. |
Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
Reference Data | |
UniProt ID | P48346 |
Synonyms | IL-T |
Summary | Interleukin-15 (IL-15) is a 14-15 kDa glycoprotein with immune regulatory functions in many diverse cell types. IL-15 can be constitutively expressed in a variety of cell types stored as intracellular protein in the cytoplasm as well as transport to the cell surface, while only secreted from some cell types including monocytes, dendritic cells, epithelial cells, bone marrow stromal cells, and fibroblasts. As a pleiotropic cytokine, IL-15 mediates the crosstalk between innate immunity and adaptive immunity whose principal role is to kill virally infected cells. IL-15 plays a crucial role in the development, differentiation, and survival of NK cells. In monocytes, IL-15 induces the production of IL-8 and monocyte chemotactic protein 1 (MCP-1), which recruits neutrophils and monocytes to sites of infection. IL-15 can also act as a chemo-attractant in T lymphocytes and regulate the differentiation of T lymphocytes. |
Documents
FAQs |
SDS |
Customer
Reviews
Loading...