Recombinant IL-15 (Interleukin-15)，Mouse

Specifications

Product Data
Species	Mouse
Expression Host	E. coli
Expression cDNA Clone or AA Sequence	Protein Sequence (showhide) NWIDVRYDLEKIESLIQSIHIDTTLYTDSDFHPSCKVTAMNCFLLELQVILHEYSNMTLNETVRNVLYLANSTLSSNKNVAESGCKECEELEEKTFTEFLQSFIRIVQMFINTS with polyhistidine tag at the N-terminus.
Tag	His Tag (N-term)
Predicted MW	The protein has a calculated MW of 14.2 kDa. The protein migrates as 11-14 kDa under reducing condition (SDS-PAGE analysis).
Purity	>98% as determined by SDS-PAGE.
Buffer	The protein was lyophilized from a 0.2 µm filtered solution of Proleukin buffer, pH 7.5.containing 1X PBS, pH 7.4.
Applications	Cell culture
Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity	Measure by its ability to induce CTLL-2 cells proliferation. The ED₅₀ for this effect is <10 ng/mL. The specific activity of recombinant mouse IL-15 is approximately >1x 10⁵ IU/mg.
Endotoxin	<0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID	P48346
Synonyms	IL-T
Summary	Interleukin-15 (IL-15) is a 14-15 kDa glycoprotein with immune regulatory functions in many diverse cell types. IL-15 can be constitutively expressed in a variety of cell types stored as intracellular protein in the cytoplasm as well as transport to the cell surface, while only secreted from some cell types including monocytes, dendritic cells, epithelial cells, bone marrow stromal cells, and fibroblasts. As a pleiotropic cytokine, IL-15 mediates the crosstalk between innate immunity and adaptive immunity whose principal role is to kill virally infected cells. IL-15 plays a crucial role in the development, differentiation, and survival of NK cells. In monocytes, IL-15 induces the production of IL-8 and monocyte chemotactic protein 1 (MCP-1), which recruits neutrophils and monocytes to sites of infection. IL-15 can also act as a chemo-attractant in T lymphocytes and regulate the differentiation of T lymphocytes.

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.