Recombinant IL-1 alpha (Interleukin-1 alpha)，Mouse

Specifications

Product Data
Species	Mouse
Expression Host	E. coli
Expression cDNA Clone or AA Sequence	Protein Sequence (showhide) MSAPYTYQSDLRYKLMKLVRQKFVMNDSLNQTIYQDVDKHYLSTTWLNDLQQEVKFDMYAYSSGGDDSKYPVTLKISDSQLFVSAQGEDQPVLLKELPETPKLITGSETDLIFFWKSINSKNYFTSAAYPELFIATKEQSRVHLARGLPSMTDFQIS with polyhistidine tag at the C-terminus.
Tag	His Tag (C-term)
Predicted MW	The protein has a calculated MW of 18.93 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Purity	>95% as determined by SDS-PAGE.
Buffer	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications	Cell culture
Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity	Measure by its ability to induce D10.G4.1 cells proliferation. The ED₅₀ for this effect is <5 pg/mL. The specific activity of recombinant mouse IL-1 alpha is > 2 x 10⁸ IU/mg.
Endotoxin	<0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID	P01582
Synonyms	Hematopoietin-1, Lymphocyte-Activating Factor (LAF), Endogenous Pyrogen (EP), Leukocyte
Summary	Interleukin-1 alpha (IL1 alpha or IL1α) is a member of the interleukin-1 cytokine family, found constitutively present in epithelial layers of the entire gastrointestinal tract, lung, liver, kidney, endothelial cells, and astrocytes. The synthesized IL-1 alpha is a 31 kDa inactive precursor and can be cleaved by intracellular caspase-1 or extracellular proteases to generate the bioactive 17 kDa form and the 16 kDa N-terminal cleavage product. Both precursor and mature IL-1 alpha protein bind to the IL-1 receptor (IL-1R), initiating a cascade of inflammatory cytokines and chemokines production such as IL-6, IL-8, and TNF, in response to viral and bacterial pathogens conditions. IL-1 alpha plays a central role in immune-surveillance mechanisms, stimulating macrophages, neutrophils, and CD8+ T cells activity.

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.