Recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand),Mouse

CAT#: TP728320L

Recombinant Flt-3 Ligand (Fms-related tyrosine kinase-3 ligand),Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 22,000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPR with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 19.3 kDa. The protein migrates as 19 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce proliferation in BaF3 cells transfected with mouse Flt-3. The ED₅₀ for this effect is <2 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P49772
Synonyms Fetal liver kinase 2, FLK-2
Summary Fms-related tyrosine kinase-3 ligand (Flt-3 Ligand) is a protein which is encoded by the Flt3lg gene in mouse. As an important regulator of hematopoiesis, Flt-3 ligand has a tyrosine-protein kinase activity that stimulate the proliferation of hematopoietic progenitor cells of both lymphoid and myeloid origin. Flt-3 ligand can synergistically increase the proliferation of immature progenitors with other cytokines such as GM-CSF, G-CSF, IL-3, EPO, IL-11, IL-12, IL-6 or TPO. Flt-3 ligand is expressed by a variety of hematopoietic progenitor cells including immature hematopoietic and marrow stromal cells.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...