Recombinant FasL (Fas ligand),Mouse

CAT#: TP728317S

Recombinant FasL (Fas ligand),Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 700.00


货期*
2周

规格
    • 5 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
QIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 18.27 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce apoptosis in Jurkat cells. The ED₅₀ for this effect is <1 μg /mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P41047
Synonyms soluble Fas Ligand (sFasL), TNFSF6, CD95L, Apo I Ligand, APTL, APT1LG1, CD178, Fas-Lg, Tnfs, Tnlg1a, gld
Summary Fas Ligand (FasL) is a 17.34 kDa tumor necrosis factor with 152 amino acid residues. FasL is mainly expressed from lymphoid tissue and secreted to blood. Binding to its receptor, TNFRSF6/FAS, leads to induce apoptotic signal into cells. Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...