Recombinant CXCL7 (48-109) (C-X-C motif chemokine 7)，Mouse

Specifications

Product Data
Species	Mouse
Expression Host	E. coli
Expression cDNA Clone or AA Sequence	Protein Sequence (showhide) IELRCRCTNTISGIPFNSISLVNVYRPGVHCADVEVIATLKNGQKTCLDPNAPGVKRIVMKI with polyhistidine tag at the N-terminus.
Tag	His Tag (N-term)
Predicted MW	The protein has a calculated MW of 7.57 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).
Purity	>98% as determined by SDS-PAGE.
Buffer	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications	Cell culture
Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity	Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <5 ng/mL.
Endotoxin	<0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
RefSeq	NP_076274
UniProt ID	Q9EQI5
Synonyms	NAP-2, PPBP, CT, CTA, CTAP3, CTAPIII,LA-PF4, LDG, LDGF, MDGF, NAP-2-L1, Scyb, Scyb7, TGB, TGB1, THBGB1, b-TG1, beta-T, beta-TG
Summary	C-X-C motif chemokine 7 (CXCL7) also named Pro-Platelet basic protein (PPBP), which is a chemokine of the intercrine alpha family. CXCL7 is a 8.2 kDa protein containing 74 amino acid residues. CXCL7 is expressed by the platelets, which are activated. During vascular injury, CXCL7 controls the glucose metabolism, mitogenesis and neutrophil recruitment by the interaction with CXCR2.

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.