Recombinant CXCL12 (C-X-C motif chemokine 12),Mouse

CAT#: TP728308S

Recombinant CXCL12 (C-X-C motif chemokine 12),Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 700.00


货期*
2周

规格
    • 5 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 8.97 kDa. The protein migrates below 8-11 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to chemoattract BaF3 cells transfected with human CXCR4. The ED₅₀ for this effect is <0.5 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P40224
Synonyms PB, PBSF/SD, Pbsf, SDF-, Scyb1, Scyb12, Sdf, Sdf1, TLS, TP, Tlsf, Tpar1
Summary C-X-C motif chemokine 12 (CXCL12) also named stromal cell-derived factor 1 (SDF-1), which is a chemokine of the intercrine alpha family. CXCL12 is a 7.8 kDa protein containing 70 amino acid residues. CXCL12 has a key role in controling the immune responses which is often induced by the lipopolysaccharide or IL-1. CXCL12 also activates the leukocytes during inflammation. CXCL12 induces the migration and proliferation of cells like hematopoietic progenitor, stem cells and leukocytes.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...