Recombinant CXCL1 (C-C motif chemokine ligand 1), Mouse
CAT#: TP728305S
Recombinant CXCL1 (C-C motif chemokine ligand 1), Mouse
Need it in bulk or customized? Get a free quote |
CN¥ 700.00
货期*
2周
规格
Specifications
Product Data | |
Species | Mouse |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK.
|
Tag | Tag Free |
Predicted MW | The protein has a calculated MW of 7.45 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis). |
Purity | >95% as determined by SDS-PAGE. |
Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5. |
Applications | Cell culture |
Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
Bioactivity | Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <15 ng/mL. |
Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
Reference Data | |
UniProt ID | P12850 |
Synonyms | GRO-α: MGSAα, NAP-3, GRO1, KC (murine) |
Summary | C-X-C motif chemokine 1 (CXCL1) also named Growth-regulated oncogene alpha (GROα), which is a chemokine of the intercrine alpha family. CXCL1 is a 7.5 kDa protein containing 68 amino acid residues. CXCL1 is often expressed in immune cells such as macrophage and neutrophils. CXCL1 plays an important role with immune responses and cancer progression. CXCL1 activates the cell signal transduction with casepas1 that affects the cell proliferation, differentiation and migration. |
Documents
FAQs |
SDS |
Customer
Reviews
Loading...