Recombinant CXCL1 (C-C motif chemokine ligand 1)，Mouse

Specifications

Product Data
Species	Mouse
Expression Host	E. coli
Expression cDNA Clone or AA Sequence	Protein Sequence (showhide) NELRCQCLQTMAGIHLKNIQSLKVLPSGPHCTQTEVIATLKNGREACLDPEAPLVQKIVQKMLKGVPK.
Tag	Tag Free
Predicted MW	The protein has a calculated MW of 7.45 kDa. The protein migrates below 11 kDa under reducing condition (SDS-PAGE analysis).
Purity	>95% as determined by SDS-PAGE.
Buffer	The protein was lyophilized from a 0.2 µm filtered solution containing 50 mM Tris and 150 mM NaCl, pH 8.5.
Applications	Cell culture
Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity	Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <15 ng/mL.
Endotoxin	<0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID	P12850
Synonyms	GRO-α: MGSAα, NAP-3, GRO1, KC (murine)
Summary	C-X-C motif chemokine 1 (CXCL1) also named Growth-regulated oncogene alpha (GROα), which is a chemokine of the intercrine alpha family. CXCL1 is a 7.5 kDa protein containing 68 amino acid residues. CXCL1 is often expressed in immune cells such as macrophage and neutrophils. CXCL1 plays an important role with immune responses and cancer progression. CXCL1 activates the cell signal transduction with casepas1 that affects the cell proliferation, differentiation and migration.

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.