Recombinant CCL4 (C-C Motif Chemokine Ligand 4)，Mouse

Specifications

Product Data
Species	Mouse
Expression Host	E. coli
Expression cDNA Clone or AA Sequence	Protein Sequence (showhide) APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN with polyhistidine tag at the N-terminus.
Tag	His Tag (N-term)
Predicted MW	The protein has a calculated MW of 8.64 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Purity	>98% as determined by SDS-PAGE.
Buffer	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications	Cell culture
Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity	Measure by its ability to chemoattract human PBMCs using a concentration range of 20.0 - 200.0 ng/mL. Note: Results may vary from different PBMC donors.
Endotoxin	<0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID	P14097
Synonyms	MIP-1b: Macrophage Inflammatory Protein-1β, ACT-2
Summary	C-C Motif Chemokine Ligand 4 (CCL4) is a 7.66 kDa cytokine with 69 amino acid residues. CCL4, also named macrophage inflammatory protein-1β (MIP-1β), is mainly secreted from neutrophils, monocytes, B cells, T cells, fibroblasts, endothelial cells, and epithelial cells. In addition, CCL4 participates in immune responses, including recruitment of immune cells like lymphocytes, monocytes, and leukocytes, response to IL-1 and IFNγ, and production of TNF when CCL4 binds to CCR5.

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.