Recombinant CCL3 (C-C Motif Chemokine Ligand 3), Mouse

CAT#: TP728301M

Recombinant CCL3 (C-C Motif Chemokine Ligand 3), Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 4,880.00


货期*
2周

规格
    • 100 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
APYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 8.69 kDa. The protein migrates about 11 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to chemoattract human PBMCs using a concentration range of 10.0 - 100.0 ng/mL. Note: Results may vary from different PBMC donors.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P10855
Synonyms MIP-1a: Macrophage Inflammatory Protein-1α, LD78α
Summary C-C Motif Chemokine Ligand 3 (CCL3) is a 7.66 kDa cytokine with 69 amino acid residues. CCL3, also known as macrophage inflammatory protein 1-alpha (MIP-1-alpha), is expressed in the spleen, lung, and articular cartilage. Upon binding to the receptor, CCR1, CCR4, or CCR5, CCL3 plays a vital role in immune response, such as inflammation, recruitment of immune cells, and production of IL-1β and TNF. In addition, CCL3 also participates in resistance to type 1 virus infection, astrocyte cell migration, regulation of macromolecule metabolic process, and regulation of ERK1 and ERK2 cascade.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...