Recombinant beta-NGF (Nerve growth factor-beta), Mouse

CAT#: TP728298S

Recombinant beta-NGF (Nerve growth factor-beta), Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 700.00


货期*
2周

规格
    • 5 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MSSTHPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLAEVNINNSVFRQYFFETKCRASNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDEKQAAWRFIRIDTACVCVLSRKATRRG with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 14.41 kDa. The protein migrates as 11-17 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 4.5.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <1ng/mL. The specific activity of recombinant mouse beta-NGF is > 1 x 10⁶ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P01139
Synonyms β-Nerve Growth Factor, NGF-β
Summary Beta-Nerve Growth Factors (Beta-NGF) is a 27 kDa cytokine with 241 amino acid residues. Beta-NGF belongs to neurotrophin family, and acts as neurotrophic factors. It's composed of alpha, beta, gamma subnuits, and the beta subunit is related to its biological activity. Beta-NGF binds to p75 neurotrophin receptor and Trk receptor and their function is about cell death and survival, respectively.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...