Recombinant BAFF (B-cell activating factor),Mouse

CAT#: TP728297

Recombinant BAFF (B-cell activating factor),Mouse

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Mouse
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 21.56 kDa. The protein migrates as 17-25 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce proliferation in mouse B cells. The ED₅₀ for this effect is <0.5 ng/mL. The specific activity of recombinant mouse BAFF is > 2 x 10⁶ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID Q9WU72
Synonyms tumor necrosis factor (ligand) superfamily, member 13b,Tnfsf13b, BAF, BL, BLyS, D8Ertd387, D8Ertd387e, TAL, TALL-1, TALL1, THANK, TNFSF20, Tnlg7a, zTNF, zTNF4
Summary BAFF also known as BLYS, TALL-1 and TNFSF13B, which belongs to tumor necrosis factor family. BAFF is a 31.2 kDa type II transmembrane protein containing 285 residues that predominantly produced by myeloid cells, furthermore mouse BAFF shares 72% sequence identity with human BAFF. BAFF has been demonstrated to activate the survival of B cells and the B cell response by binding to BAFFR/BR3. Additionally, BAFF also takes part in regulating B and T cell function via forming two ligands-two receptors pathway through sharing TNFRSF13B/TACI and TNFRSF17/BCMA receptors with APRIL.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...