Recombinant TL1A (TNF-like ligand 1A), Human

CAT#: TP728288M

Recombinant TL1A (TNF-like ligand 1A), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 4,880.00


货期*
2周

规格
    • 100 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MQLRAQGEACVQFQALKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL with polyhistidine tag at the C-terminus
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 22.95 kDa. The protein migrates as 24 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce TF-1 cells proliferation. The ED₅₀ for this effect is <0.2 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID O95150
Synonyms TNFSF15, VEGI
Summary TL1A also known as VEGI and TNFSF15, which belongs to TNF ligand superfamily. TL1A is a 28 kDa type II membrane protein containing 251 residues that predominantly expressed in endothelial cells. TL1A is able to promote NFκB activation in cells by interacting with DR3. Besides, TL1A can also induces cell apoptosis through activating caspases. Additionally, the responsiveness of IL-2 from activated T cells has been shown to induce by TL1A treatment.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...