Recombinant TGF beta 1 (Transforming growth factor beta 1),Human

CAT#: TP728284

Recombinant TGF beta 1 (Transforming growth factor beta 1),Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 13.7 kDa. The protein migrates as 13 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 4.5.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to inhibit the IL-4 dependent proliferation in HT-2 cells. The ED₅₀ for this effect is <0.1 ng/mL. The specific activity of recombinant human TGF beta 1 is approximately >5 x 10⁷ IU/mg. Measure by its ability to induce proliferation in MCF-7 cells. The ED₅₀ for this effect is <3.2 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P01137
Synonyms Differentiation inhibiting factor, Cartilage-inducing factor, CED, DPD1, IBDIMDE, LAP, TGFB
Summary The transforming Growth Factors beta (TGF beta) family of cytokines are ubiquitous, multifunctional, and essential to survival. They play the central roles in growth, development, inflammation, repair, and host immunity. The mammalian TGF beta isoforms (TGF beta 1, beta 2 and beta 3) are secreted as potential precursors and possess a variety of cell surface receptors and produces at least two mediate signal transductions.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...