Recombinant TGF alpha (Transforming growth factor alpha), Human

CAT#: TP728283L

Recombinant TGF alpha (Transforming growth factor alpha), Human

Size: 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 7,800.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 6.49 kDa. The protein migrates as 7 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is <0.2 ng/mL. The specific activity of recombinant human TGF alpha is > 5 x 10⁶ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P01135
Synonyms Sarcoma growth factor, TGF-type I, ETGF, TGFA
Summary Transforming Growth Factors alpha (TGF-α) is a 5.68 kDa member of the epidermal Growth Factors with 51 amino acid residues. TGF-α is mainly expressed from brain, skin, epithelial cell (pancreatic endocrine cells, urothelial cells, oligodendrocyte precursor cells, etc.). TGF-α is a regulator of cell proliferation and differentiation via bind to the EGFR and to act synergistically with TGF β. TGF-α also associates with myriad forms of cancer.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...