Recombinant LIGHT, Human

CAT#: TP728276L

Recombinant LIGHT, Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 22,000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 20.30 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 0.1% sarkosyl in 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce cytotoxicity in HT-29 cells in the presence of IFN-gamma. The ED₅₀ for this effect is < 10 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID O43557.2
Synonyms TNFSF14, HVEM-L, CD258, LTg
Summary LIGHT, also known as TNFSF14 is a member of the TNF superfamily that produced by multiple immune cells such as activated T cells and immature dendritic cells (DCs). LIGHT is a 29 kDa type II transmembrane protein, which serves as a ligand for both lymphotoxin β receptor (LTβR) and TNFSF signaling receptors (TNFRSF14/HVEM). Besides, LIGHT can amplify NF-kB signaling pathway in T cells when presenting anti-CD3 antibody treatment. Additionally, LIGHT can stimulate T cell proliferation and IFN-expression via interacting with TNFRS13 /HVEM.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...