Recombinant IL-9 (Interleukin-9), Human

CAT#: TP728274

Recombinant IL-9 (Interleukin-9), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 14.93 kDa. The protein migrates as 13-17 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce proliferation in MO7e cells. The ED₅₀ for this effect is <0.25 ng/mL. The specific activity of recombinant human IL-9 is approximately >5 x10⁶ IU/ mg.
Endotoxin <0.01 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P15248
Synonyms p40 cytokine, T-cell growth factor p40, HP40
Summary Interleukin 9 (IL-9) is a pleiotropic cytokine that had pleiotropic functions in the immune system, has a molecular mass of 14.5 kDa. The major source of IL-9 is T lymphocytes. It is secreted by CD4+ helper cells that acts as a regulator of a variety of hematopoietic cells.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...