Recombinant IL-36RA (Interleukin-36 receptor antagonist),Human

CAT#: TP728267

Recombinant IL-36RA (Interleukin-36 receptor antagonist),Human



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSCGVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENGGWNAPITDFYFQQCD with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 17.77 kDa. The protein migrates as 17 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to inhibit IL-36 gamma-induced IL-8 secretion in PBMC cells. The ED₅₀ for this effect is <2 ng/mL in the presence of 500 ng/mL of recombinant human IL-36 gamma.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID Q9UBH0
Synonyms FIL1 delta, IL-1F5, IL-1HY1, IL-1L1, IL-1RP3, IL-1ra Homolog 1, IL-1 delta
Summary Interleukin 36 receptor antagonist (IL-36RA) is a 16.97 kDa member of IL-1 family with 155 amino acid residues. IL-1RA is expressed by lymphoid tissue, skin and secreted to blood. IL-36Ra functions as a receptor antagonist that inhibits the activation of IL-36R signaling and suppresses pro-inflammatory signaling.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...