Recombinant IL-36 beta (Interleukin-36 beta), Human

CAT#: TP728265M

Recombinant IL-36 beta (Interleukin-36 beta), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 4,880.00


货期*
2周

规格
    • 100 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 18.17 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce IL-8 secretion in human PBMCs. The ED₅₀ for this effect is <0.2 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
RefSeq NP_775270.1
Synonyms IL-1F8, IL-1H2, IL-1 eta
Summary Interleukin-36 beta (IL-36β) is an 18 kDa cytokine with 154 amino acid residues. IL-36β, the ligand of IL-36R, is expressed in keratinocytes and plays a significant role in inflammatory responses. IL-36β regulates biological functions like the differentiation of T cells. Moreover, IL-36β recruits neutrophils via inducing the expression of cytokines and chemokines, such as IL-17C, granulocyte colony-stimulating factor (G-CSF), IL-8, CXCL-1, and tumor necrosis factor (TNF).
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...