Recombinant IL-12 (p70) (Interleukin-12 p70), Human,HEK293

CAT#: TP728237

Recombinant IL-12 (p70) (Interleukin-12 p70), Human,HEK293

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGSTSGSGKPGSGEGSTKGRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASHHHHHH with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 59.55 kDa. The protein migrates as 63-75 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce IFN gamma secretion in PHA-activated human peripheral blood lymphocytes (PBMC). The ED₅₀ for this effect is 0.05-0.2 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P29459
Synonyms Interleukin-12, NKSF,Cytotoxic Lymphocyte Maturation Factor (CLMF), TSF
Summary Interleukin 12 p70 (IL-12 p70) is an interleukin which is major secreted from immune cells like dendritic cells, macrophages and neutrophils. IL-12 p70 is a 58.5 kDa protein containing 527 amino acid residues which is composed by two subunits (IL-12 p35 and IL-12 p40). IL-12 p70 induces the cytotoxic activity of immune cells like NK cells and T cells. IL-12 p70 binds its receptor (IL-12Rβ1 and IL-12Rβ2) that activates the Jak/STAT signaling pathway. IL-12 p70 also plays an important role in cancer model which inhibits the formation of new blood vessels through the production of IFN γ.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...