Recombinant IFN beta 1a (Interferon beta 1a),Human

CAT#: TP728227

Recombinant IFN beta 1a (Interferon beta 1a),Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 20.84 kDa. The protein migrates as 15 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce apoptosis in HeLa cells. The ED₅₀ for this effect is <15 ng/mL. Measure by its ability to induce cytotoxicity in TF-1 cells. The ED₅₀ for this effect is <0.1 ng/mL. The specific activity of recombinant human IFN beta 1a is approximately >1 x10⁷ IU/ mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P01574
Synonyms IFNB1, Type I Interferon
Summary Interferon-Beta 1a (IFN-beta 1a) is a leukocyte interferon, which is a variant of Interferon-beta. IFN-beta 1a is a 19 kDa protein containing 166 amino acid residues. It could bind the interferon receptors that activates the signal transduction of immune responses through the Jak/STAT pathway in leukocytes and lymphoblastoid cells.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...