Recombinant HMGB1, Human (mammalian cell expression)
CAT#: TP728225
Recombinant HMGB1, Human (mammalian cell expression)
Need it in bulk or customized? Get a free quote |
CN¥ 2,700.00
货期*
2周
规格
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKARYEREMKTYIPPKGETKKKFKD
PNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKK
KKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE with polyhistidine-SUMO tag at the N-terminus
|
Tag | His-SUMO Tag (N-term) |
Predicted MW | The protein has a calculated MW of 36.42 kDa. The protein migrates as 35-48 kDa under reducing condition (SDS-PAGE analysis). |
Purity | >98% as determined by SDS-PAGE. |
Buffer | The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4. |
Applications | Cell culture |
Storage | Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles. |
Bioactivity | Measure by its ability to induce TNF alpha in RAW264.7 cells. The ED₅₀ for this effect is <10 μg/mL. |
Endotoxin | <0.1 EU per 1 μg of the protein by the LAL method. |
Reference Data | |
UniProt ID | P09429 |
Synonyms | HMG-1, HMG1, HMG3, SBP-1 |
Summary | High mobility group protein B1 protein (HMGB1) is the high mobility group box family of non-histone chromosomal proteins. Human HMGB1 is expressed as a 25 kDa single chain polypeptide containing three domains: two N-terminal HMG boxes A and B, and a negatively charged 30 a.a. C-terminal region that contains only Asp and Glu. Post-translational modification on HMGB1 have been reported, affects its localization, receptor interactions, and function. HMGB1, with a disulfide bond between C23 and C45 , have been reported that cause cytokine production and the activation of NF-κB. Otherwise, the fully oxidized form has no immune function, losing its proinflammatory effect and the apoptotic cell death activation function. |
Documents
FAQs |
SDS |
Customer
Reviews
Loading...