Recombinant Galectin-7, Human

CAT#: TP728216S

Recombinant Galectin-7, Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 700.00


货期*
2周

规格
    • 5 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 15.9 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measured by its ability to agglutinate human red blood cells. The ED₅₀ for this effect is <2 μg/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P47929
Synonyms LGALS7B, LGALS7, PI7; GAL7, Gal-7, HKL-14
Summary Galectin-7 (Gal-7) is a lectin family member and is one of the prototype galectins. It contains one carbohydrate recognition domain (CRD), responsible for β-galactoside binding, and is biologically active as homodimers. Galectin-7 is constitutively presented in the gastrointestinal tract, stratified epithelia, skin, and fetal heart. It has been reported that galectin-7 serves as an effector in triggering apoptosis following activation of the p53 pathway. Furthermore, it serves important functions in numerous biological activities including cell adhesion, migration, proliferation, and differentiation.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...