Recombinant FGF-8b (Fibroblast growth factor-8b),Human

CAT#: TP728209

Recombinant FGF-8b (Fibroblast growth factor-8b),Human



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MQHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIVLENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHHTTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 22.14 kDa. The protein migrates as 23 kDa under reducing condition (SDS-PAGE analysis).
Purity >95% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is 1.4-3.8 ng/mL. The specific activity of recombinant human FGF-8b is > 2 x 10⁵ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P55075
Synonyms AIGF, HBGF-8
Summary Fibroblast Growth Factors-8b (FGF-8b) is a 21.3 kDa member of the fibroblast Growth Factors with 183 amino acid residues. FGF-8 is an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. In embryogenesis function, FGF8 is necessary in limb, brain, eye and ear formation. FGF-8b having a more potent inductive activity due to higher affinity for Fgf receptors.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...