Recombinant FGF-18 (Fibroblast growth factor-18), Human

CAT#: TP728197L

Recombinant FGF-18 (Fibroblast growth factor-18), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 22,000.00


货期*
2周

规格
    • 1 mg

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 21.11 kDa. The protein migrates as 20 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce 3T3 cells proliferation. The ED₅₀ for this effect is 1.3-2.0 ng/mL. The specific activity of recombinant human FGF-18 is > 5 x 10⁵ IU/mg.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID O76093
Synonyms FGFI, zFGF5
Summary Fibroblast Growth Factors-18 (FGF-18) is a 24 kDa member of the fibroblast Growth Factors with 207 amino acid residues. FGF-18 is mainly expressed from glandular and luminal cells, cardiomyocytes, breast myoepithelial cells and endometrial ciliated cells. FGF-18 involved cell proliferation, cell differentiation and cell migration. FGF-18 is an important role in skeletal growth and development, stimulates hepatic and intestinal proliferation.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...