Recombinant CXCL7 (C-X-C motif chemokine 7),Human

CAT#: TP728184

Recombinant CXCL7 (C-X-C motif chemokine 7),Human



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 8.43 kDa. The protein migrates as 11 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to chemoattract BaF3 cells transfected with human CXCR2. The ED₅₀ for this effect is <0.5 ng/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P02775
Synonyms Neutrophil Activating Protein-2, NAP-2, PBP (parent molecule), CTAP-III (precursor)
Summary C-X-C motif chemokine 7 (CXCL7) also named Pro-Platelet basic protein (PPBP), which is a chemokine of the intercrine alpha family. CXCL7is a 7.7 kDa protein containing 70 amino acid residues. CXCL7 is expressed by the platelets, which are activated. During vascular injury, CXCL7 controls the glucose metabolism, mitogenesis and neutrophil recruitment by the interaction with CXCR2.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...