Recombinant CXCL4 (C-X-C motif chemokine 4)，Human

Specifications

Product Data
Species	Human
Expression Host	E. coli
Expression cDNA Clone or AA Sequence	Protein Sequence (showhide) EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES with polyhistidine tag at the N-terminus.
Tag	His Tag (N-term)
Predicted MW	The protein has a calculated MW of 8.58 kDa. The protein migrates as 14 kDa under reducing condition (SDS-PAGE analysis).
Purity	>98% as determined by SDS-PAGE.
Buffer	The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications	Cell culture
Storage	Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity	Measure by its ability to inhibit human FGF-2-induce proliferation in HUVEC cells. The ED₅₀ for this effect is <5 μg/mL.
Endotoxin	<0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID	P02776
Synonyms	Platelet Factor-4,PF-4, Oncostatin A, Ironplact
Summary	C-X-C motif chemokine 4 (CXCL4) also named platelet factor 4 (PF4), which is a chemokine of the intercrine alpha family. CXCL4 is a 8kDa protein containing 70 amino acid residues. CXCL4 is produced by the activated platelets which plays an important role in immune responses. CXCL4 inhibit the cell proliferation, platelet aggregation and wound repair. CXCL4 also suppresses the hematopoiesis.

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.