Recombinant CD30L (CD30 ligand), Human

CAT#: TP728169S

Recombinant CD30L (CD30 ligand), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CNY 700.00


货期*
2周

规格
    • 5 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 20.57 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 1X PBS, pH 7.4.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce IL-8 secretion in human PBMCs using a concentration range of 10 - 100 ng/mL. Note: Results may vary from different PBMC donors.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P32971
Synonyms soluble CD30 Ligand, TNFSF8, CD153, sCD30 Ligand
Summary Human CD30L is also named for CD153 and TNFSF8 which is one member of TNF family. Human CD30L is expressed on T cells. It binds the CD30, which is on some lymphoma cell lines. Human CD30L is a 30 kDa cytokine with 171 amino acid residues which is a transmembrane glycoprotein. Human CD30L plays an important role in the regulation of cell proliferation, activation and apoptosis. Human CD30L is a good target of cell therapy in inflammatory diseases.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...