Recombinant BMP-8b (Bone morphogenetic protein-8b),Human

CAT#: TP728163

Recombinant BMP-8b (Bone morphogenetic protein-8b),Human



Need it in bulk or customized?
Get a free quote

CN¥ 1,890.00


货期*
2周

规格
    • 20 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
AVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQVCRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPDAVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH with polyhistidine tag at the N-terminus.
Tag His Tag (N-term)
Predicted MW The protein has a calculated MW of 16.48 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED₅₀ for this effect is <21.8 ng/mL.
Endotoxin <0.01 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID P34820
Synonyms OP-2 (Osteogenic Protein-2), BMP8
Summary Bone Morphogenetic Protein-8B (BMP-8B) is an extracellular multifunctional signaling cytokine that is also a member of the TGF-β family. BMP-8B can bind with the TGF-β receptor and is involved in SMAD protein signal transduction. BMP-8B plays a role in bone and cartilage development. It is expressed in brown adipose tissues and the hypothalamus, which can affect thermogenesis and susceptibility to obesity.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...