Recombinant APRIL (A proliferation-inducing ligand), Human

CAT#: TP728146S

Recombinant APRIL (A proliferation-inducing ligand), Human

Size: 5 ug 20 ug 100 ug 1 mg



Need it in bulk or customized?
Get a free quote

CN¥ 700.00


货期*
2周

规格
    • 5 ug

Product images

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MAVLTQKQKKQHSVLHLVPINATSKDDSDVTEVMWQPALRRGRGLQAQGYGVRIQDAGVYLLYSQVLFQDVTFTMGQVVSREGQGRQETLFRCIRSMPSHPDRAYNSCYSAGVFHLHQGDILSVIIPRARAKLNLSPHGTFLGFVKL with polyhistidine tag at the C-terminus.
Tag His Tag (C-term)
Predicted MW The protein has a calculated MW of 17.29 kDa. The protein migrates as 18 kDa under reducing condition (SDS-PAGE analysis).
Purity >98% as determined by SDS-PAGE.
Buffer The protein was lyophilized from a 0.2 µm filtered solution containing 0.1% sarkosyl in 1X PBS, pH 8.0.
Applications Cell culture
Storage Lyophilized protein should be stored at -20°C for 1 year. Upon reconstitution, store at 2°C to 8°C for up to 1 week. Further dilute in a buffer containing a carrier protein or stabilizer (e.g. 0.1% BSA, 10%FBS, 5%HSA or 5% trehalose solution), protein aliquots should be stored at -20°C or -80°C for 3-6 months. Avoid repeated freeze/thaw cycles.
Bioactivity Measured by its ability to induce cell death in Jurkat cells. The ED₅₀ for this effect is 2.6-4.0 μg/mL.
Endotoxin <0.1 EU per 1 μg of the protein by the LAL method.
Reference Data
UniProt ID AAQ91388
Synonyms TNFSF13, CD256, TALL-2, TALL2, TNLG7B, TRDL-1, UNQ383/PRO715, ZTNF2
Summary APRIL is a member of tumor necrosis factor ligand superfamily that expressed by stromal tissue, macrophages, and T cells. APRIL is a 27.4 kDa protein containing 250 residues, which plays a critical role in modulating tumor progression. Besides, APRIL has been demonstrated to involve in regulating B and T cell survival, proliferation and differentiation via binding with TNFRSF13B/TACI and TNFRSF17/BCMA.
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...