Cxcl12 (NM_021704) Mouse Recombinant Protein
CAT#: TP527145
Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Cxcl12" proteins (2)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR227145 protein sequence
Red=Cloning site Green=Tags(s) MDAKVVAVLALVLAALCISDGKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQV CIDPKLKWIQEYLEKALNK myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 10 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_068350 |
Locus ID | 20315 |
UniProt ID | P40224 |
Refseq Size | 1878 |
Cytogenetics | 6 F1 |
Refseq ORF | 270 |
Synonyms | PB; Pbsf; PBSF/SD; Scyb1; Scyb12; Sdf; SDF-; Sdf1; TLS; Tlsf; TP; Tpar1 |
Summary | This gene encodes a member of the alpha chemokine protein family. The encoded protein is secreted and functions as the ligand for the G-protein coupled receptor, chemokine (C-X-C motif) receptor 4. The encoded protein plays a role in many diverse cellular functions, including embryogenesis, immune surveillance, inflammation response, tissue homeostasis, and tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP723771 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12 / SDF-1alpha), transcript variant 1 |
CNY 5,150.00 |
|
TP723857 | Purified recombinant protein of Mouse chemokine (C-X-C motif) ligand 12 (Cxcl12 / SDF-1beta), transcript variant 2 |
CNY 5,150.00 |