Sct (NM_011328) Mouse Recombinant Protein
CAT#: TP526326
Purified recombinant protein of Mouse secretin (Sct), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
货期*
4周
规格
Product images
经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR226326 representing NM_011328
Red=Cloning site Green=Tags(s) MEPPLPTPMLLLLLLLLSSSAALPAPPRTPRHSDGMFTSELSRLQDSARLQRLLQGLVGKRSEQDTENIP ENSLARSKPLEDQLCLLWSNTQTLQDWLLPRLSLDGSLSLWLPPGPRSAVDRSEWTETTRPPR myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 15.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_035458 |
Locus ID | 20287 |
UniProt ID | Q08535 |
Refseq Size | 507 |
Cytogenetics | 7 F5 |
Refseq ORF | 399 |
Summary | This gene encodes the precursor of a gastrointestinal peptide hormone of the secretin-glucagon family. The encoded protein is secreted as a prohormone that undergoes proteolytic processing to generate a mature peptide hormone. The mature peptide regulates secretion of gastric acid, biocarbonate ions from pancreatic and biliary duct epithelia and water homeostasis in the gastrointestinal system. Mice lacking the encoded protein display decreased survival of neuroprogenitor cells during early postnatal period and impaired long-term potentiation and spatial learning in adulthood. Alternative splicing results in multiple transcript variants encoding different isoforms. All of these isoforms may be processed in a similar manner to generate the mature peptide hormone. [provided by RefSeq, Jul 2015] |
Documents
FAQs |
SDS |
You may also need
Customer
Reviews
Loading...