Sh3kbp1 (NM_001135727) Mouse Recombinant Protein

CAT#: TP526320

Purified recombinant protein of Mouse SH3-domain kinase binding protein 1 (Sh3kbp1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR226320 representing NM_001135727
Red=Cloning site Green=Tags(s)

MVEAIVEFDYQAQHDDELTISVGEVITNIRKEDGGWWEGQINGRRGLFPDNFVREIKKDMKKDLLSNKAP
EKPMHDVSSGNALLSSETILRTNKRGERRRRRCQVAFSYLPQNDDELELKVGDIIEVVGEVEEGWWEGVL
NGKTGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKSEGANGTMATAAIQPKKV
KGVGFGDIFKDKPIKLRPRSIEVENDFLPVEKTIGKKLPPATSTPDPSKTEMDSRTKTKDYCKVIFPYEA
QNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPSDFDKEGNRPKKPPPPSAPVVKQ
GAGTTERKHEIKKIPPERPETLPNRTEEKERPEREPKLDLQKPSVPAIPPKKPRPPKTNSLNRPGALPPR
RPERPVGPLTHTRGDSPKIDLAGSALSGILDKDLSDRSNDIDLEGFDSVISSTEKLSHPTTSRPKATGRR
PPSQSLTSSSLSSPDIFDSPSPEEDKEEHISLAHRGIDVSKKTSKTVTISQVSDNKTSLPPKPGTMAAAS
SGPASLSSVASSPMSSSLGTAGQRASSPSLFSTEGKPKMEPAVSSQAAIEELKMQVRELRTIIETMKDQQ
KREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 73.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_001129199
Locus ID 58194
UniProt ID Q8R550, Q3TT90, Q3TA88
Refseq Size 5029
Cytogenetics X F4
Refseq ORF 1995
Synonyms 1200007H22Rik; 1700125L08Rik; 5830464D22Rik; AI447724; Cin85; IN85; Ruk; Seta
Summary Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through an association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may be inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor. Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit. May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape and migration (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...