Fa2h (NM_178086) Mouse Recombinant Protein

CAT#: TP526165

Purified recombinant protein of Mouse fatty acid 2-hydroxylase (Fa2h), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR226165 protein sequence
Red=Cloning site Green=Tags(s)

MAPAPPPAASFTPAEVQRRLAAGACWVRRGASLYDLTSFVRHHPGGEQLLLARAGQDISADLDGPPHRHS
DNARRWLEQYYVGELRADPQDPTENGAVASAETQKTDPALEPQFKVVDWDKDLVDWQKPLLWQVGHLGEK
YDEWVHQPVARPIRLFHSDLIEAFSKTVWYSVPIIWVPLVLYLSWSYYRTLTQDNIRLFASLTREYSMMM
PESVFIGLFVLGMLFWTFVEYVIHRFLFHMKPPSNSHYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLV
IAFFYVFLRLILPETVGGIIFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYNMKAHHVKHHFEYQKSGFGI
STKLWDYFFHTLIPEEAHPKMQ

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 43 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_835187
Locus ID 338521
UniProt ID Q5MPP0
Refseq Size 2492
Cytogenetics 8 E1
Refseq ORF 1119
Synonyms FAAH; Faxdc1; G630055L08Rik
Summary Catalyzes stereospecific hydroxylation of free fatty acids at the C-2 position to produce (R)-2-hydroxy fatty acids, which are building blocks of sphingolipids and glycosphingolipids common in neural tissue and epidermis (PubMed:15658937, PubMed:16998236). Plays an essential role in the synthesis of galactosphingolipids of the myelin sheath (PubMed:15658937, PubMed:18815260). Responsible for the synthesis of sphingolipids and glycosphingolipids involved in the formation of epidermal lamellar bodies, critical for skin permeability barrier (By similarity). Participates in the synthesis of glycosphingolipids and a fraction of type II wax diesters in sebaceous gland, specifically regulating hair follicle homeostasis (PubMed:21628453). Involved in the synthesis of sphingolipids of plasma membrane rafts, controlling lipid raft mobility and trafficking of raft-associated proteins (PubMed:22517924).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...