Ndrg4 (NM_145602) Mouse Recombinant Protein

CAT#: TP525446

Purified recombinant protein of Mouse N-myc downstream regulated gene 4 (Ndrg4), transcript variant B, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR225446 protein sequence
Red=Cloning site Green=Tags(s)

MPECWDGEHDIETPYGLLHVVIRGSPKGNRPAILTYHDVGLNHKLCFNTFFNFEDMQEITKHFVVCHVDA
PGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYVIGIGVGAGAYVLAKFALIFPDLVEGLVLMNID
PNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNNTELVQSYRQQISNVVNQANLQLFWNMYNSRRD
LDINRPGTVPNAKTLRCPVMLVVGDNAPAEEGVVECNSKLDPTTTTFLKMADSGGLPQVTQPGKLTEAFK
YFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQPCAHSDSSEGMGQVNHTMEVSC

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 37.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_663577
Locus ID 234593
UniProt ID Q8BTG7
Refseq Size 2927
Cytogenetics 8 D1
Refseq ORF 1020
Synonyms D8Bwg1337e; Ndr1-rs; Ndr4; R74996; SMAP-8
Summary Contributes to the maintenance of intracerebral BDNF levels within the normal range, which is necessary for the preservation of spatial learning and the resistance to neuronal cell death caused by ischemic stress. May enhance growth factor-induced ERK1 and ERK2 phosphorylation. May attenuate NGF-promoted ELK1 phosphorylation in a microtubule-dependent manner.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...