Nr0b1 (NM_007430) Mouse Recombinant Protein

CAT#: TP524919

Purified recombinant protein of Mouse nuclear receptor subfamily 0, group B, member 1 (Nr0b1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
Rabbit Polyclonal Anti-Nr0b1 Antibody
    • 50 ug

CNY 4,628.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR224919 representing NM_007430
Red=Cloning site Green=Tags(s)

MAGEDHPWQGSILYNLLMSAKQKHASQEEREVRLGAQCWGCACGAQPVLGGERLSGGQARSLLYRCCFCG
ENHPRQGGILYSMLTNARQPSVATQAPRARFGAPCWGCACGSAEPLVGREGLPAGQAPSLLYRCCFCGEE
HPRQGSILYSLLTSAQQTHVSREAPEAHRRGEWWQLSYCTQSVGGPEGLQSTQAMAFLYRSYVCGEEQPQ
QISVASGTPVSADQTPATPQEQPRAPWWDASPGVQRLITLKDPQVVCEAASAGLLKTLRFVKYLPCFQIL
PLDQQLVLVRSCWAPLLMLELAQDHLHFEMMEIPETNTTQEMLTTRRQETEGPEPAEPQATEQPQMVSAE
AGHLLPAAAVQAIKSFFFKCWSLNIDTKEYAYLKGTVLFNPDLPGLQCVKYIEGLQWRTQQILTEHIRMM
QREYQIRSAELNSALFLLRFINSDVVTELFFRPIIGAVSMDDMMLEMLCAKL

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 53 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_031456
Locus ID 11614
UniProt ID Q61066, Q53ZY9
Refseq Size 1794
Cytogenetics X 39.67 cM
Refseq ORF 1416
Synonyms AH; Ahc; Ahch; AHX; Dax; DAX-; DAX-1; Dax1
Summary This gene encodes an orphan nuclear receptor protein that plays a key role in differentiation of the gonads. This protein regulates steroidogenic factor 1 (Sf-1) in a dose-dependent manner, sometimes functioning as a repressor of SF-1 target genes, and sometimes functioning as a co-activator. Overexpression of this gene can cause feminization of the XY male gonads. This gene is also involved in the maintenance of embryonic stem cell pluripotancy. Mutations in the related gene in human cause congenital adrenal hypoplasia and hypogonadotropic hypogonadism. [provided by RefSeq, May 2015]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...