Piwil4 (NM_177905) Mouse Recombinant Protein
CAT#: TP524497
Purified recombinant protein of Mouse piwi-like RNA-mediated gene silencing 4 (Piwil4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR224497 representing NM_177905
Red=Cloning site Green=Tags(s) MRLRILGVHRALPTHARVAVCSNYLGKLEYSQTPSHSHTVSFAKEKTLLLRLTSPGKPLAPRNMSGRARV RARGITTGHSAREVGRSSRDLMVTSASPGDSEAGGGTSVISQPYELGVSSGDGGRTFMERRGKGRQDFEE LGVCTREKLTHVKDCKTGSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSILSD KAKAFDGASLFLSEKLDQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQI GRNFYKPSEPVEIPQYNKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTRYNN KTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRNDNSEPQMVHLMPE LCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRTLPSSQEVLSHTSLPLWAPEPGGLS SAIPLSTVLPFAQQLLTALSLSPGIPLPHLKPPSFLFLCQPAFAADWSKDMRSCKVLSSQPLNRWLIVCC NRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVDETPAAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSI KKYLSSDCPVPSQCVLTRTLNKQGTMLSVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKN VVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKA VLEYEVPQLLKSVTECGSDARYDFYLISQTANRGTVSPTHYNVIYDDNALKPDHMQRLTFKLCHLYYNWQ GLISVPAPCQYAHKLTFLVAQSVHKEPSLELANNLFYL myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 99.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
Locus ID | 330890 |
UniProt ID | Q8CGT6, A0A0R4J0Y7 |
Refseq Size | 2637 |
Cytogenetics | 9 A2 |
Refseq ORF | 2634 |
Synonyms | 9230101H05Rik; Miwi2 |
Summary | Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity (PubMed:17395546, PubMed:18381894, PubMed:18922463, PubMed:26669262, PubMed:22020280). Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons (PubMed:17395546, PubMed:18381894, PubMed:18922463, PubMed:26669262, PubMed:22020280). Directly binds piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Associates with secondary piRNAs antisense and PIWIL2/MILI is required for such association (PubMed:17395546, PubMed:18381894, PubMed:18922463, PubMed:26669262, PubMed:22020280). The piRNA process acts upstream of known mediators of DNA methylation (PubMed:17395546, PubMed:18381894, PubMed:18922463, PubMed:26669262, PubMed:22020280). Does not show endonuclease activity (PubMed:22020280). Plays a key role in the piRNA amplification loop, also named ping-pong amplification cycle, by acting as a 'slicer-incompetent' component that loads cleaved piRNAs from the 'slicer-competent' component PIWIL2 and target them on genomic transposon loci in the nucleus (PubMed:22020280). In addition to its role in germline, PIWIL4 also plays a role in the regulation of somatic cells activities. Plays a role in pancreatic beta cell function and insulin secretion (By similarity). Involved in maintaining cell morphology and functional integrity of retinal epithelial through Akt/GSK3alpha/beta signaling pathway (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |