Piwil4 (NM_177905) Mouse Recombinant Protein

CAT#: TP524497

Purified recombinant protein of Mouse piwi-like RNA-mediated gene silencing 4 (Piwil4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (2)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

CNY 1,050.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR224497 representing NM_177905
Red=Cloning site Green=Tags(s)

MRLRILGVHRALPTHARVAVCSNYLGKLEYSQTPSHSHTVSFAKEKTLLLRLTSPGKPLAPRNMSGRARV
RARGITTGHSAREVGRSSRDLMVTSASPGDSEAGGGTSVISQPYELGVSSGDGGRTFMERRGKGRQDFEE
LGVCTREKLTHVKDCKTGSSGIPVRLVTNLFNLDLPQDWQLYQYHVTYSPDLASRRLRIALLYNHSILSD
KAKAFDGASLFLSEKLDQKVTELTSETQRGETIKITLTLTSKLFPNSPVCIQFFNVIFRKILKNLSMYQI
GRNFYKPSEPVEIPQYNKLLFNADVNYKVLRNETVLDFMTDLCLRTGMSCFTEMCHKQLVGLVVLTRYNN
KTYRIDDIDWSVKPTQAFQKRDGSEVTYVDYYKQQYDITLSDLNQPVLVSLLKRKRNDNSEPQMVHLMPE
LCFLTGLSSQATSDFRLMKAVAEETRLSPVGRQQQLARLVDDIQRTLPSSQEVLSHTSLPLWAPEPGGLS
SAIPLSTVLPFAQQLLTALSLSPGIPLPHLKPPSFLFLCQPAFAADWSKDMRSCKVLSSQPLNRWLIVCC
NRAEHLIEAFLSCLRRVGGSMGFNVGYPKIIKVDETPAAFLRAIQVHGDPDVQLVMCILPSNQKNYYDSI
KKYLSSDCPVPSQCVLTRTLNKQGTMLSVATKIAMQMTCKLGGELWSVEIPLKSLMVVGIDICRDALNKN
VVVVGFVASINSRITRWFSRCVLQRTAADIADCLKVCMTGALNRWYRHNHDLPARIVVYRDGVGNGQLKA
VLEYEVPQLLKSVTECGSDARYDFYLISQTANRGTVSPTHYNVIYDDNALKPDHMQRLTFKLCHLYYNWQ
GLISVPAPCQYAHKLTFLVAQSVHKEPSLELANNLFYL

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 99.1 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
Locus ID 330890
UniProt ID Q8CGT6
Refseq Size 2637
Cytogenetics 9 A2
Refseq ORF 2634
Synonyms 9230101H05Rik; Miwi2
Summary Plays a central role during spermatogenesis by repressing transposable elements and preventing their mobilization, which is essential for the germline integrity (PubMed:17395546, PubMed:18381894, PubMed:18922463, PubMed:26669262, PubMed:22020280). Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons (PubMed:17395546, PubMed:18381894, PubMed:18922463, PubMed:26669262, PubMed:22020280). Directly binds piRNAs, a class of 24 to 30 nucleotide RNAs that are generated by a Dicer-independent mechanism and are primarily derived from transposons and other repeated sequence elements. Associates with secondary piRNAs antisense and PIWIL2/MILI is required for such association (PubMed:17395546, PubMed:18381894, PubMed:18922463, PubMed:26669262, PubMed:22020280). The piRNA process acts upstream of known mediators of DNA methylation (PubMed:17395546, PubMed:18381894, PubMed:18922463, PubMed:26669262, PubMed:22020280). Does not show endonuclease activity (PubMed:22020280). Plays a key role in the piRNA amplification loop, also named ping-pong amplification cycle, by acting as a 'slicer-incompetent' component that loads cleaved piRNAs from the 'slicer-competent' component PIWIL2 and target them on genomic transposon loci in the nucleus (PubMed:22020280). In addition to its role in germline, PIWIL4 also plays a role in the regulation of somatic cells activities. Plays a role in pancreatic beta cell function and insulin secretion (By similarity). Involved in maintaining cell morphology and functional integrity of retinal epithelial through Akt/GSK3alpha/beta signaling pathway (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...