Atp1b3 (NM_007502) Mouse Recombinant Protein
CAT#: TP523683
Purified recombinant protein of Mouse ATPase, Na+/K+ transporting, beta 3 polypeptide (Atp1b3), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR223683 representing NM_007502
Red=Cloning site Green=Tags(s) MTKTEKKSFHQSLAEWKLFIYNPSSGEFLGRTSKSWGLILLFYLVFYGFLAALFTFTMWAMLQTLNDEVP KYRDQIPSPGLMVFPKPQTALEYTFSMSEPQTYKKLVEDLESFLKPYSVEEQKNLTSCPDGAPFIQHGPD YRACQFPVSLLEECSGVTDANFGYSKGQPCILVKMNRIIDLIPDGYPQISCLPKEENATIATYPEFGVLD LKYFPYYGKKRHVGYRQPLVAVQVKFDSGLNKKEVTVECHIAGTRNLKNKNERDKFLGRVSFKVTARA myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 32.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_031528 |
Locus ID | 11933 |
UniProt ID | P97370, Q544Q7 |
Refseq Size | 1833 |
Cytogenetics | 9 50.31 cM |
Refseq ORF | 834 |
Synonyms | AA409958; AI664000; AW212096 |
Summary | This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The exact function of the beta-3 subunit is not known.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |