Rec114 (NM_028598) Mouse Recombinant Protein

CAT#: TP523022

Purified recombinant protein of Mouse REC114 meiotic recombination protein (Rec114), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CN¥ 2,900.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CN¥ 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR223022 representing NM_028598
Red=Cloning site Green=Tags(s)

MSEAGNVASGLGLPGEVSQWSLKRYGRFMLLDNVGSPGPSSEAAAAGSPTWKVFESSEESGSLVLTIVVS
GHFFISQGQTLLEGFSLIGSKNWLKIVRRMDCLLFGTTIKNKSRMFRVQFSGESKEEALERCCGCVQTLA
QYVTVQEPDSTTQELQQSQGPREAGESQGKDPLQQGPSLTLEQHVCMAAGAGVLQERTSVTHRAQSILAP
EKLTLAYEGSSWGTEELGPFLRLCLMDQNFPAFVEEVEKELKKITGLRN

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_082874
Locus ID 73673
UniProt ID Q9CWH4
Refseq Size 883
Cytogenetics 9
Refseq ORF 777
Synonyms 2410076I21Rik; 4930527A11Rik
Summary Required for DNA double-strand breaks (DSBs) formation in unsynapsed regions during meiotic recombination (PubMed:20551173, PubMed:27723721). Probably acts by forming a complex with IHO1/CCDC36 and MEI4, which activates DSBs formation in unsynapsed regions, an essential step to ensure completion of synapsis (PubMed:27723721).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...