Csf2 (NM_009969) Mouse Recombinant Protein
CAT#: TP522594
Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "Csf2" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
CNY 600.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR222594 representing NM_009969
Red=Cloning site Green=Tags(s) MWLQNLLFLGIVVYSLSAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLTCVQ TRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTYADFIDSLKTFLTDIPFECKKPVQ K myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 16.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_034099 |
Locus ID | 12981 |
UniProt ID | P01587, Q5SX78 |
Refseq Size | 1033 |
Cytogenetics | 11 32.13 cM |
Refseq ORF | 423 |
Synonyms | CSF; Csfgm; Gm-CSf; GMCSF; MGI-IGM |
Summary | Cytokine that stimulates the growth and differentiation of hematopoietic precursor cells from various lineages, including granulocytes, macrophages, eosinophils and erythrocytes.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP723753 | Purified recombinant protein of Mouse colony stimulating factor 2 (granulocyte-macrophage) (Csf2) |
CNY 4,090.00 |
|
TP723880 | Purified recombinant protein of Rat GM-CSF (?) |
CNY 4,090.00 |
|
TP750017 | Recombinant protein of Mus musculus colony stimulating factor 2 (granulocyte-macrophage) (Csf2) produced in E. coli. |
CNY 4,020.00 |