Mfrp (NM_147126) Mouse Recombinant Protein

CAT#: TP521747

Purified recombinant protein of Mouse membrane frizzled-related protein (Mfrp), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug



Need it in bulk or customized?
Get a free quote
Avi-tag Biotinylated Protein
Get a free quote

CNY 7,106.00


货期*
4周

规格
    • 20 ug

Product images

经常一起买 (1)
DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 100 ul

CNY 600.00

Specifications

Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
>MR221747 representing NM_147126
Red=Cloning site Green=Tags(s)

MKDYDDVILRPEASELSKTEFCNPAFDPEAGPSCPPPALQRDVGSRLQAPWHAQRLRGLQPDCHFSWFCI
LLLSGLLLLLLGLLVAVILAQLQATSLPRTTKNPLLTRGLTPMGVIPSTTPNTTTTTTTTTPARTGQQEA
AMSPTHQTTCGGLLPGPSGFFSSPNYPDLYPPLSHCVWHIQVAAGQTIQLKIQALSIESMLTCLFDRLEI
ISEPTGPLLRVCGKTPPATLNTNTSHLRVSFVSDNDVEGSGFQAWYQAVAPGHWSCAHNEFHCDLLLCLK
RDSVCDGITECADGSDEANCSAKTLGCGGNLTGLYGVFSTPNYPQHYPHQQLCTWYIEVPVGYGIRLEFH
NFSLEAQAECKFDYVEVYEASNLGTFSFLGRFCGAEPPLNVVSSMHQLAVIFKTDLGISSGGFLATYQAI
NTTESGCPWAEFCQSGGYRDLQWMCDLWKDCANDSNDNCSSHLSPQPDLTCEPVQVEMCLGLSYNTTAFP
NIWVGLATQTEVTDILRGYKSLTSLPCYQTFQRFLCGLLVPRCTSLGTILPPCRSVCQAAEQQCQSSLAL
LGTPWPFNCNRLPVAASLEACSQP

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 63.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Reference Data
RefSeq NP_667337
Locus ID 259172
UniProt ID Q8K480
Refseq Size 4292
Cytogenetics 9 24.6 cM
Refseq ORF 1752
Synonyms rd6
Summary The protein encoded by this gene contains a region with similarity to the cysteine-rich domain (CRD) of frizzled, a gene originally found in Drosophila that controls tissue polarity. This protein functions in eye development, where it is necessary for the maintenance of photoreceptor outer segments. Mutations in this gene cause retinal degeneration 6 in mice, which gives rise to a mouse model for human retinitis punctata albescens. Bicistronic transcripts composed of the coding sequences for this gene (Mfrp) and the C1q and tumor necrosis factor related protein 5 gene (C1qtnf5) have been identified, and the resulting products can interact with each other. Co-transcription of C1qtnf5 and Mfrp has been observed in both human and mouse. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2010]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Documents

Customer Reviews 
Loading...